Search the Web Search www.SterlingDaySpa.com


homeservicespackagesspecialsgift certificate
Book Your Service Online!location


MASSAGE
| HAIR | NAILS | SAUNA | WAXING


FACIALS

Express-Facial (25 min.) - $51
This facial service includes a skin specific cleanse, hydrating toner, a skin analysis, specialty exfoliation, and a skin specific moisturizer. This treatment may include the use of hot towels
European Facial (50 min.) - $75
This facial service begins with a skin specific cleanse, hydrating toner, a skin analysis, specialty exfoliation, a relaxing facial, hand / foot, or scalp massage, treatment facial mask, and skin specific moisturizer. Treatment may include the use of hot towels and aromatic scents to create an individualized experience.
Age Smart Facial (60 min.) - $110
This facial addresses the special needs of prematurely aged skin. The client will experience a resurfacing cleanse, face mapping... Give your face a workout!! It will stimulate your facial muscles while getting a deep cleansing in your pores following with a antioxidant mask, a relaxing lifting facial massage and hydrating pepticles.
Medibac Clearing Facial (50 min.) - $87
Dermalogica MediBac Clearing is a 24-hour treatment system composed of products that work together to provide immediate and long-term solutions for adult acne.

 

Body Scrubs / Wraps

Every 21 to 28 days, your superficial layer of skin dies as new skin cells are formed. This is why exfoliation is so important! Dead skin clogs pores and absorbs moisturizers. This means your new "baby" skin is not only missing the limelight, it's also missing out on vital moisture and nutrients! Relax as we slough off dead skin, to reveal a fresh, glowing new you!

Sugar Scrub (Upper Back) - $65.00

Sugar Cane has naturally occurring alpha hydroxyl acid (a natural glycolic), a great benefit for skin exfoliation! Also, it melts fast when it hits heat and moisture, which may be better for people with sensitive skin.  It’s unlikely you’ll be over-scrubbed with sugar.  Our scrubs use only natural ingredients, to protect and respect your body.

Salt Scrub (Upper Back) - $65.00
For those with serious dry skin, this is the scrub for you!   Sea Salt is coarser, for a more vigorous scrub, and it pulls impurities out from deep within the pores, for a cleaner, brighter complexion.  And of course, our scrubs use only natural ingredients to protect and respect your body.
Full Body Exfoliation - $95
If you enjoy the Sugar Scrub or Salt Scrub, try it for the full body!
The Shrink Wrap - $135
Our most popular wrap! We use Set-N-Me-Free‘s unique aloe vera based solution, High in herbal content, with no unhealthy chemicals! The basic principle is the diffusion of bulky fat cells. This promotes the size loss. There is a protein wall within the skin which houses toxins that cling to bulky fat cells. These natural herbs penetrate through the protein wall and attack the toxins that cling to the fat cells. These toxins are then released into the body’s lymphatic system, and it’s this movement of the freed fat cells that causes size loss. Fat cells can then be flushed from the body by drinking water.
  First, we do full body measurements. After dry brushing and application, you’ll be snugly wrapped in plastic cling wrap. This ensures that your body absorbs all the valuable nutrients. You’ll be kept slightly warm (think absorption, not excretion through sweat) for about half an hour, then we remove the wrap and re-measure!  Standard recommendation is a package of 5 wraps, done once a week. It’s most advantageous to truly purify the body, and no body can free all toxins in one session. Discounts apply with  package, but all five wraps must be used within two months of purchase.
Full Body Salt Scrub with Mud Wrap - $145
Indulge your skin with our nourishing, intensely hydrating mud wraps!  After your dry brushing and exfoliation, we apply a thick layer of warm crème-based mud to your torso, arms, and legs. Then, you’ll be wrapped (loosely!)  to achieve maximum absorption.  After about 30 minutes, you’ll do NOTHING as our state of the art Vichy shower rinses away excess mud!

 

TEETH WHITENING

Teeth Whitening
1st Application $150
2nd Application $75